DPCstruct | MC3194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8NMW5 | 1-190 | MSTQTNAAANDEFPVLPRCVNPEGIFWTAIWYVPTCAPSFPVCAYCYEKHIQPTPHAGLFEAVWLKGGDTSLLCQWNTPRVMAHLAA… |
| A0A1Y2DQL8 | 631-831 | GKRWFVPKEGPQGIVFCHACYCDQVVHTGQESNWREAVELTKLFSNHVRCAMGQFNIKITMARRTDTKDYSVFWAVVNKVVKEKMCD… |
| A0A194XDX1 | 2-228 | None |
| A0A545UN94 | 194-379 | None |
| A0A166BLS1 | 258-495 | None |
| A0A6A6FFK2 | 42-209 | None |
| A6QU07 | 1-186 | None |
| M7T7A2 | 2-234 | None |
| M2Y5F3 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.