DPCstruct | MC31937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7KYL0 | 1-159 | MSIQQCNLVLVHIYPQGEETLVSDRPKKEISPLLTSEVHSVRAGRHLASKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVEL… |
| A0A2S2NR79 | 21-181 | MSIHHCHLVIINTYPDSITCEVTDHPSHTISPILDLEVHSIPASKIGIKISNLLLKHYNLASTTVTGIPMKEEQNASSSANYDVEIY… |
| A0A2Z6QFK6 | 93-222 | None |
| A0A819EHW9 | 194-322 | None |
| A0A7R8CGD0 | 456-608 | None |
| A0A0D8XHJ1 | 164-319 | None |
| A0A7R9L5J6 | 213-344 | None |
| A0A3Q0IPR2 | 108-249 | None |
| A0A2H1C5D3 | 158-311 | None |
| A0A4Z2IDK5 | 197-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.