DPCstruct | MC31936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VRV4 | 210-306 | AVCMGCLEGWTVRLRCRRCHQPWDGSHLILGTMYTFDIFAATPCCSERLKCNECDSPVIAPDQRLNFYSDYSHMVSCPFCTALENHF… |
| A0A0S7KSJ7 | 6-103 | ICVDCLEGVHKIVCIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVVDVRVGMQYFSEYSNVQQCPHCGNLDYHFVK… |
| T1EGF4 | 79-202 | None |
| A0A6P8R530 | 218-320 | None |
| A0A7M7GJ60 | 533-628 | None |
| A0A1B0BEY6 | 7-118 | None |
| A0A6P8Q634 | 302-404 | None |
| T0MHX5 | 328-427 | None |
| A0A7R8D4V8 | 247-336 | None |
| A0A1W7RAG0 | 314-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.