DPCstruct | MC31935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210PHE7 | 1-117 | MDDQTLALYIPHLGDRIAVKDYCSHPKKTQAEDRKRTLLMSLKKKLSSENDGKHCKKFKHLPGNTNAKKNTRKIELGLLNLDNNVFK… |
| A0A0S7KS46 | 1-129 | MTDEELKSYLPSYGDRIALLGYCKRKETGPPNSRKSKLFERLKSKLGKRKTAHQDGCGLEKEEQSETNVKKNALKSKRKIEIGWLLY… |
| V4B8D8 | 3-121 | None |
| A0A2B4S716 | 419-566 | None |
| A0A6S7FZ03 | 6-166 | None |
| A0A2I4CV39 | 19-176 | None |
| A0A7D9LC34 | 1-140 | None |
| K1PN60 | 1-133 | None |
| A0A1S3ITU6 | 1-137 | None |
| A0A8B6EYC3 | 6-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.