DPCstruct | MC31932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 58.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02138 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2U797 | 5-79 | LTPEWYSDPSFLVNGNCFDLGTSVDGKAISDVVLPPWAEGSPSKFVDVMRQALESNVCSSMLSSWIDLIFGFKQR |
| A0A453CP81 | 210-283 | LVPEMFYLPEVFTNINSIDFGTTQLGGKLDSVELPPWAENPVDFVHKHRKALESEHVSTHLHHWIDLIFGYKQR |
| A0A3P6YD33 | 134-208 | None |
| A0A1D6E3S7 | 475-548 | None |
| A0A2J6MEK7 | 118-184 | None |
| A0A2J8JGL7 | 92-166 | None |
| A0A446LCR6 | 1174-1246 | None |
| A0A6P5ZX86 | 2-60 | None |
| A0A818QVQ8 | 1-71 | None |
| A0A3Q0EJF7 | 113-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.