DPCstruct | MC31923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 182 ± 41 aa |
| Standard deviation of domain lengths | 40.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5HZ98 | 66-221 | KEIKDKLFTMAKISELRDRHLLNFNPLEIEKIEIRHKKNLIVLEKKKRRWKIKAPFEKLADNPKIWKVLFSIKDLEFKKVIKEKLDN… |
| A0A7C0V3R6 | 50-254 | EFVEEHPEDLTQYGLAPPAYAIDLYLAPNNAKKTLFIGKKKDDKYYYARDESRSPVFLVSKQVTNVLKQSVYNLRDKQIVNYDKYKV… |
| A0A7W0Q974 | 85-308 | None |
| A0A1V5ZGH4 | 26-194 | None |
| B3T1J4 | 141-280 | None |
| A0A3M1INZ5 | 37-201 | None |
| R6V8K7 | 225-468 | None |
| A0A0S8CQP2 | 18-162 | None |
| A0A7X7F7V0 | 8-145 | None |
| R5TSR2 | 5-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.