DPCstruct | MC31921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 477 |
|---|---|
| Mean domain length (aa) | 162 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.51 |
| Pfam Score | 97.58 |
| Assigned Pfam label(s) | PF20182- CL0126- PF09856 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9VKD1 | 3-130 | DPEDKLESLGVHVVERDLSSIGVDGLYDADTHTVFVHDGLTPGQRRATLAHELAHAERGEGAAPSAWHEHKQERRADTKSARWLVGF… |
| A0A2T3ILT8 | 25-176 | TPDQLIHVVQDKVNIGEDILCAIARIFNLRVEYMPLELEESGTLSYDKEVDQWLITINSLHHPKRQRFTFAHELAHFFLHRDSQYDF… |
| A0A0N0K1E4 | 5-134 | None |
| K2DLC6 | 8-182 | None |
| A0A7V6KXG2 | 10-185 | None |
| A0A6I2YAT0 | 26-206 | None |
| A0A1I4PLK5 | 8-168 | None |
| A0A661F2E9 | 223-381 | None |
| A0A6S6XL05 | 160-318 | None |
| A0A2G9Z466 | 8-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.