DPCstruct | MC31918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9IMJ9 | 47-196 | HELGHCLGLTHGGTDHENWKPNYLSVMNYFFQTWGLYKNGQWGDAGYPLNFDYQRINTPSLNKAALQEGLGLTGVDDVSAYGTRYWY… |
| A0A060HHI4 | 32-184 | HELGHNLGLRHGGGVDINCKPNYLSVMNYAFTFPAPVSNRPLDYSRSALATLDEVELYEPDGVSASTPSGLTTAYGQTGVSPTIRTA… |
| A0A3E0PMX2 | 335-472 | None |
| A0A1Q7KX43 | 369-564 | None |
| A0A0Q9SYQ2 | 541-739 | None |
| A0A517NZL5 | 488-625 | None |
| A0A7C2Q4T0 | 459-629 | None |
| A0A7W5YCX6 | 16-201 | None |
| A0A2E6XHS6 | 314-457 | None |
| A0A7W5V1U5 | 320-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.