DPCstruct | MC31916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 211 ± 47 aa |
| Standard deviation of domain lengths | 47.48 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 68.49 |
| Assigned Pfam label(s) | PF20737- CL0059- PF20736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0WWS3 | 411-646 | CFWCCVGTGMENPGRYGQFIYARDADGGLYVNLFVPSVLTVQDGLEIRQENNFPQQPRTKLTFSVENSTEWTLRIRHPWWTPAGDMA… |
| A0A6D0ELZ3 | 23-167 | DDALFINLYVGNSMVFPVGDQELQLRISGNYPWQDQVTITITSPVPVEHTLALRLPDWCDAPQLTLNGETLQGEVRQGYLYLNRRWQ… |
| A0A286CAZ4 | 121-331 | None |
| A0A8B3C739 | 506-731 | None |
| A0A7C3U866 | 1-146 | None |
| A0A564RUE1 | 151-365 | None |
| A0A287XE75 | 45-199 | None |
| A0A3D5W3C5 | 2-155 | None |
| W0EV91 | 539-765 | None |
| A0A6N2SBB1 | 129-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.