DPCstruct | MC31911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6XYH5 | 14-199 | ESFFEQLEEISENIDCYLLDILPMTVQDPEKYAQFELVWEHIVDDEHFLKQKAFFVEEEKFVSFFKKLWLYNKTKVYVHEFSRPKEC… |
| A0A1G6KMS1 | 3-129 | RVEELMKTQSWVVDILPARVPKGSRGQYFAIEKHFLKEQLANIKQKHVNVILKLNCYMDISVDEEINPFPERIKSIMNERSVFIITG… |
| I7J3I7 | 45-227 | None |
| H5XE82 | 2-130 | None |
| U3C6Z9 | 14-140 | None |
| A0A162DN15 | 8-180 | None |
| A0A0U4BX72 | 8-157 | None |
| A0A105TNT0 | 4-147 | None |
| A0A2G7DZA5 | 4-174 | None |
| A0A356KY64 | 95-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.