DPCstruct | MC31910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542QSC6 | 136-216 | MDNDQILGSISDLVDEERALRARSSDEHGLDPDQRARLRDLEVQLDQCWDLLRRRRAKAEFGEDPDTARVQPADEVEGYLS |
| A0A6J7JE59 | 2-84 | PTDDELQNRIETLEQEQHRLREREGEPEPDPTLEEDAARIEEIRVDLEVLWDLLRQRRALREAGEDPDGAAPRSPETIERYWQ |
| A0A7Z0D6L4 | 12-90 | None |
| A0A537Y321 | 1-80 | None |
| A0A542GF44 | 13-107 | None |
| A0A1C4W8V2 | 18-113 | None |
| A0A1E8Q432 | 1-82 | None |
| A0A212RIA7 | 328-415 | None |
| H0QQT6 | 1-99 | None |
| A0A239AW86 | 49-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.