DPCstruct | MC3191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 217 ± 53 aa |
| Standard deviation of domain lengths | 53.29 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09678 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0A766 | 25-230 | VLLAGLAMAIVLIGRTARPRPALAGVAVLAIVFVSPLCAISVALFSARALHHILIVAVAAPLIALAFPARRSGALGCAFVSATALLW… |
| A0A7G6Y0X8 | 70-267 | RASRPRAERLPVRRGALAAGLALFPLGWAASSVTVGAWAMTGHMVAHMIAVAVAAPLVAFGVQGTRADPAGRWPRAATPSAAALIEA… |
| A0A7C2KU43 | 44-290 | None |
| A0A1L3T005 | 6-169 | None |
| A0A847A2P0 | 161-429 | None |
| A0A318L3H9 | 41-306 | None |
| A0A2A3YFE1 | 270-538 | None |
| A0A7Y3KRZ5 | 1-149 | None |
| A0A538I9E4 | 149-396 | None |
| A0A6I2LY17 | 29-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.