DPCstruct | MC31907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9WLC0 | 1-144 | MSRLYALLGLLASAAALNPSCSPGGNFDLTKWNLQLPTGSTGSPQTISGSSLAGCSGYSSSVFYTDGSTGELVMTVPGSPSSAGCVT… |
| W7SZK9 | 1-128 | MNKTITAGLCALGLLLAAGPATAAPALNPAAAPGGNFDLSHWQLQLPIGSPGNPTEIAPAKLTGANGFQDAYFYTDKTDGSMTFWSP… |
| A0A090T475 | 1-117 | None |
| A0A090S0Z3 | 49-178 | None |
| A0A194UY51 | 1-129 | None |
| G7EBB9 | 21-129 | None |
| A0A086TEZ4 | 125-242 | None |
| A0A1Y2B8G4 | 1-116 | None |
| A0A0B8QLK6 | 1-100 | None |
| A0A090X342 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.