DPCstruct | MC31906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 109 ± 20 aa |
| Standard deviation of domain lengths | 20.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9JHL7 | 1-68 | MTKVVGSTLYLRTASGETVKVKTTGTTKIRIVEDGKLRDLGAGATVVVQGSTGQDGALTATSVNEGSG |
| W7SXG8 | 14-123 | ALAFTLAACGGSSPAAPAGNPSGKQQTPGGNRNGGAPPGVFGSIAAVSGQTLQVQNPQSGQTAVTYDGSTKITNSVAGTLADVTSGA… |
| A0A2G9YVD0 | 24-127 | None |
| A0A257RRC0 | 24-134 | None |
| A0A2H0DTG7 | 4-82 | None |
| A0A2N0DJ05 | 3-105 | None |
| A0A1V4DZ74 | 1-80 | None |
| A0A2V7HL04 | 1-68 | None |
| A0A536BEV1 | 18-162 | None |
| A0A3A4W3I3 | 24-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.