DPCstruct | MC31903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7SIJ9 | 19-103 | QQQLDSVTTSIAEIPNAINGVSLNSGVYLTPKSYGPIIDGKDVFQEAVNKILTGIGLHPQIVDDFLNLHMDDGELHCGTNTFRKV |
| A0A7J8KDQ6 | 27-133 | RELGLTERDIVDIPQLFFLRGAYAEAFFPDMVNMVVLGKYLGIPKPFGPIINGRCCLEEKVRSLLEPLGLHCVFINDYLSYHKLLGE… |
| A0A554K9V5 | 588-701 | None |
| N1R9B9 | 217-320 | None |
| A0A1G9JGE6 | 1121-1265 | None |
| A0A0F8AWD8 | 478-579 | None |
| A0A1E2Y7L8 | 772-885 | None |
| A0A7Y4P133 | 322-431 | None |
| A0A674HN24 | 913-1017 | None |
| F5UGR1 | 768-897 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.