DPCstruct | MC319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7PRR7 | 3-134 | RLLLLCLGLLALLTACGPIYDTQYSLIPPTSIEGRNCVGQCQQNRSICRQTCTIGQQSCLNEARSRALYEYQAYVERQTAEKKPIKR… |
| A0A1I6KU03 | 16-136 | LGFRLLGCLGLILAQAACTTYQYVPPTTETGRQCVMTCETGHQACVGDAQYSADRRARSCEVDRSITLKKCLERASSDAEARTCNNS… |
| A0A2G8N552 | 10-140 | None |
| A0A1I7KNZ4 | 1-148 | None |
| A0A437MGR1 | 2-121 | None |
| A0A1T1IGF1 | 3-109 | None |
| A0A4R3MWG4 | 1-123 | None |
| A0A7D0MQF5 | 6-124 | None |
| A0A2R7Q9V6 | 2-117 | None |
| A0A377G7M1 | 42-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.