DPCstruct | MC31891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 76.02 |
| Assigned Pfam label(s) | CL0123- PF09722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1BFB2 | 80-210 | EFRRLDPRSPELRAAETQAVLRLFAAWQLGREEQAGLLGLDARGLDGYLDGRPLADDAVLLSRVGHLLAINKRLRRRYGEAADCPAE… |
| G6EF15 | 3-109 | RAVLNLFGKWELTDEQAATLLDMPVRSYRRWKAEGAGRVSRDGAARLSNLMGIHKALRIIFSEAQRGYAWIKAGNAAFAGASALDVM… |
| A0A2G2NYR6 | 602-714 | None |
| A0A432ZT21 | 10-127 | None |
| A0A350T791 | 6-124 | None |
| A0A2E3EMA6 | 5-114 | None |
| A0A350NYJ3 | 1-118 | None |
| A0A654D0I2 | 164-287 | None |
| A0A120DV85 | 6-129 | None |
| A0A086MIY4 | 57-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.