DPCstruct | MC3189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FAQ0 | 102-276 | EVLAEHLEDTDAARRRGDPVQGSYDDMVRLAAALERVPAMHRIEVGKWLLERLARPAEKAHTWWALGRVGARESLYGSAHNVVPPET… |
| A0A7V2SZN4 | 72-258 | FGQVAKAIMPKTKGRKKGPKPTKIGGEERREILLLLGALEKVSPDKKVGLGRYVLEELGKKGVVRSSEPHTKALVWLIGKVGAREPF… |
| A0A257VE43 | 167-342 | None |
| A0A084XUF2 | 529-706 | None |
| A0A3M1NF52 | 2-185 | None |
| A0A2V8F0U3 | 462-635 | None |
| A0A3A0D7E1 | 308-517 | None |
| A0A7Z8R4K1 | 2-179 | None |
| A0A090T9H3 | 1-152 | None |
| A0A645D2Q1 | 42-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.