DPCstruct | MC31889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 327 |
|---|---|
| Mean domain length (aa) | 253 ± 70 aa |
| Standard deviation of domain lengths | 70.45 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 99.55 |
| Assigned Pfam label(s) | PF00079- PF00067- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MF69 | 5-258 | IINNFTSNILNHLCASQNGNVAITGIGFYMLMAAIKFRVQGRSYDQLSRIIEHDFHQLYDPHTWIHTRTAKKWNFLRFLANAIPDMR… |
| A0A3Q7WMJ7 | 71-301 | FKDSAKCSQAGRIHSEFGVLFSQINQPDSNYTLSMANRLYGTKAVVFHQGKSVFVEMMYQTGTYKLAFIKDPQMQVLELPYVNNKLS… |
| A0A2R3N122 | 144-434 | None |
| A0A4Y2UCX3 | 62-319 | None |
| A0A5P1F8G5 | 2-213 | None |
| A0A445CBV1 | 70-386 | None |
| A0A170NJK6 | 219-520 | None |
| A0A447G2K4 | 206-520 | None |
| A0A340Y259 | 240-450 | None |
| A0A835HK11 | 571-905 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.