DPCstruct | MC31885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 156 ± 33 aa |
| Standard deviation of domain lengths | 32.81 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661BH76 | 5-147 | SEDNVIVESKAFTPDPTVSALLSGAIPGAGQIYSRAWWHAPIFILTEGYCIWRAYDANSTADSLWKLRNSLEPESPEYEQTGIEFEN… |
| A0A538TIW2 | 228-370 | VTRGGAVWRSLFLPGAGQEFANHRTRAAAWLGVALVTGAGIVVADNKVQQDATDLKWAKIDLSNAAPSQQAQSQLEVDQARRNLQAS… |
| A0A7W1C4B6 | 2-198 | None |
| A0A661AKM7 | 2-107 | None |
| A0A7V0YUL3 | 388-537 | None |
| F3ZSP0 | 82-274 | None |
| A0A1H4BWK0 | 67-280 | None |
| S3V1Q8 | 85-289 | None |
| A0A7Y5SZI2 | 17-152 | None |
| A0A7C1HFA4 | 542-693 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.