DPCstruct | MC3188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 235 ± 27 aa |
| Standard deviation of domain lengths | 27.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6PK32 | 47-277 | VYVMLLWHQHQPYYPKDQDGHFSKPWVRLHATKDYLDMVELVQEHEGLRVTFNLTPTLITQLKELEDGVEDIYWVHTEIEATRLLDS… |
| A0A1B9F8R8 | 2-243 | TLNVAFLWHMHQPLYIDPENQEFLMPWVRLHGVKAYSDMISALEGADDHVRVTFNLVPSLLYQLEQYSKKKDRFLELSRRLPQDLNF… |
| A0A661ABX1 | 241-490 | None |
| A0A7C7DHA2 | 46-286 | None |
| H6Q9A8 | 19-265 | None |
| A0A7C3R3C7 | 3-202 | None |
| A0A7C5Y239 | 5-239 | None |
| A0A2E4FEM2 | 253-533 | None |
| A0A538SPD0 | 8-244 | None |
| A0A661NV64 | 178-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.