DPCstruct | MC31877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7HGK7 | 5-132 | TKENVIIPKESIRYRIVANSNNEIDQYNKLKANEVIFPIINDIMNNSNNIVEARKNINKNIPLIENSLNDLNIKYKVSFGQNYFPTK… |
| A0A1Q6RQ21 | 31-189 | SYVKSALMRIFTAFLCLIGIFSVSCANTTTVNERDVLRLHIRADSNAAEDQEVKLKVRDKIIEYLADLDARSVKDAKRKVASKTNTL… |
| A0A416IGN3 | 118-260 | None |
| D9STP5 | 44-222 | None |
| A0A6S6XSZ5 | 20-213 | None |
| A0A847C8A8 | 2-128 | None |
| C7HA23 | 45-215 | None |
| A0A7C6UVP9 | 6-180 | None |
| E6SIZ5 | 36-186 | None |
| A0A2N5MBK5 | 9-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.