DPCstruct | MC31876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 200 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0H0G5 | 1-192 | MTILLYQSELVRLKSCTIKPSRIRAAKSKCLSYALSIADNYNFKCEKVPEKYWSTTITPWNLYCAVILINHNFNFPQHRLNSNDPRP… |
| A0A1R0GY08 | 109-282 | TIQLYISELYRSKKHSIHPGRIRSAKRKAIASAISLVEASKMEFKFKPKPFWNKALSLWTISCSLILLNLRFVEDYDLVGSPKQYFE… |
| A0A2U1IY48 | 338-549 | None |
| A0A1R1XF19 | 186-367 | None |
| A0A1R1YGJ0 | 231-419 | None |
| A0A2T9Z5J9 | 335-559 | None |
| A0A2T9YRV2 | 352-583 | None |
| A0A1R1YQ14 | 275-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.