DPCstruct | MC31875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1XJA3 | 72-145 | ISESYSWPRLLLPAMKRSGHVLVDVCSSNGDTERRIFTKSHSNQSYRDARKVQWGDLFPHNPKTTLTKKISYKP |
| A0A6J3LTF0 | 433-493 | LPRTVFPPLKRTGHVILDVCTPAGTLERWTVPRSFSRRAFRDARKSSWGDLWALGAKSRIV |
| A0A395IEW6 | 818-882 | None |
| A0A364N0E0 | 686-752 | None |
| A0A1B6HWF9 | 114-183 | None |
| A0A7K3HDH3 | 37-97 | None |
| W7U9Y7 | 523-586 | None |
| A0A177W9X4 | 397-458 | None |
| A0A2H9TKE0 | 338-402 | None |
| V3ZJX1 | 480-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.