DPCstruct | MC31874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 72.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1XIR8 | 1-67 | MDGAPVRGEIIPIRLFLGGFELTPTYRDVNKKFSTRYYLNLVLVDEENRRYFKQQEVTIYRESDSQE |
| A0A7R9C240 | 1-55 | MDGAPVRGESIPIRLFLAGYDLSPSMRDINKKFSVKYYLNLVLVDEEERRYFKQQ |
| A0A7R9JA30 | 55-131 | None |
| A0A0A9FFS4 | 1-67 | None |
| A0A182WJX3 | 882-950 | None |
| A0A015L8F7 | 820-881 | None |
| J5R7P8 | 177-257 | None |
| K8EQX0 | 192-256 | None |
| A0A1Z5RJW9 | 146-212 | None |
| A0A5D3CX27 | 956-1021 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.