DPCstruct | MC31871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2AUJ8 | 241-387 | LALKSAILRDGGYPREYSDDGKKPNTYHYEEREPTLDYRAMEYGKVTRHGRVDELLLEADDRFVILGGGDELLVEFDASKLPALKPG… |
| A0A3C1TSS1 | 38-183 | LRTQITRPSVARIARTGFSKRTTSGQRVPDYDYSKRSPYWDVKTHKGFYTSLGNALPLVEAADGALAIIGGGEEIHLEFDEVAEPPE… |
| A0A1G0LDT2 | 1-150 | None |
| A0A3D1LH63 | 1-113 | None |
| A0A357TJ31 | 40-217 | None |
| A0A2V9TT52 | 12-124 | None |
| A0A5E4KA08 | 7-202 | None |
| A0A1Q7TLH2 | 1-100 | None |
| A0A7W1W4Y4 | 138-289 | None |
| A0A7X7TB73 | 101-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.