DPCstruct | MC31870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 256 ± 28 aa |
| Standard deviation of domain lengths | 27.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3NBJ9 | 1-268 | MGTGSQVRLLLWKNWTLRKRQKMRFFMEIMWPVVLFIGLVWLRTANPLYRQHECHFPNKAMPSTGILPWIQGIFCNANNPCFQYATR… |
| A0A6J1P7C9 | 24-243 | LAGVLWAAMVILSLYIVRTNVDNTDYPTCQFAARALPSAGVMNFLQSFVCNVNNECSALDEFEEIPSYEKSKFTQLQRQISTIITNE… |
| A0A3Q1H0U3 | 3-232 | None |
| A0A813WHY3 | 1-241 | None |
| A0A2K6BW79 | 1-283 | None |
| A0A2R7W5E7 | 9-273 | None |
| A0A4Z2C3T3 | 1-305 | None |
| A0A7J5XGL4 | 39-299 | None |
| A0A6A5E830 | 24-285 | None |
| A0A7R8VG81 | 13-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.