DPCstruct | MC3187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 121 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5P9W8 | 2-115 | MQAGALDVYLAPLTMKKGRPAFRLSALCEEGTLQAVARAILRHTTSLGVRYKPLRRLKLQRESREVDTPWGPVHVKLAYMGDERVNA… |
| A0A1B9F793 | 233-362 | ELVTVIDDIPLEIIPHTIEKLLSKGALDAYMCPTYMKKGRPGVELKVLSPIGLEHELMAVLFYETTTTGIRVEKRHRVTLPRRHTVL… |
| R6NEP4 | 4-76 | None |
| A0A7Z8LC27 | 302-428 | None |
| A0A842SKA6 | 1-92 | None |
| A0A101JMJ3 | 123-263 | None |
| A0A7C6PRE5 | 41-163 | None |
| A0A0D2MBV1 | 9-143 | None |
| A0A1C5N2M2 | 313-443 | None |
| A0A7C0WA94 | 19-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.