DPCstruct | MC31868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 238 ± 38 aa |
| Standard deviation of domain lengths | 38.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1P745 | 1-248 | MDQVLGDERVARGFRVKFPEDVLQDNLAGQLWFGAECLAAGSSIMNREEESAAMRPLAKALTRSLETVRSLLREQCLRPRGLALQDH… |
| A0A4X1SXZ2 | 1-198 | MDVCIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGALRDQALRDLNTYTEKM… |
| A0A0A9XAD5 | 74-322 | None |
| A0A507F2N8 | 3-235 | None |
| A0A0B1TD16 | 1-248 | None |
| A0A132A763 | 179-378 | None |
| A0A671EMS5 | 71-297 | None |
| A0A482VB77 | 2-264 | None |
| A0A507EST3 | 114-350 | None |
| A0A3B3S3A7 | 68-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.