DPCstruct | MC31865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 191 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1FLC1 | 3-136 | TRLQKLVALLANGPSEAARLAAARQLGELQRAHPAQLHVLLQHILRHLFASEWPTRRAAAAALQAVAEAADAWSPEQPEEPDEAAEA… |
| A0A6J1P400 | 1-169 | MTSRLDRLFVLLEAGSGAATRRAAALQLGEVQRAHPEELHRLLARLMKHLRAAAWETRVAATQAVEAILSKVPEWHPPPFTAKEEEL… |
| A0A819LDF7 | 2-212 | None |
| A0A498IR91 | 10-234 | None |
| A0A5D2S5G3 | 10-222 | None |
| A0A3L8DEG8 | 33-207 | None |
| A0A448XJF4 | 2-179 | None |
| A0A2S4UGB9 | 6-200 | None |
| A0A183R306 | 123-331 | None |
| G2YC88 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.