DPCstruct | MC31858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 225 ± 47 aa |
| Standard deviation of domain lengths | 47.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6B344 | 2-244 | RYTALKWKYAAETLEALRRGESPAEEQVLEARGAGTDHVQDVLPALEEALYRIKSRYPNRLGLRDPAGGRFEAEACSEIHRLLPFDP… |
| A0A3M0GJY0 | 14-209 | DVTRWRAGVTGRMQDIPASTQSDQALYSKELGRAIDDVIDPSRSDAGHDGTWSYLTLMLFPDLVVKRWGPSADGKLSVDRWIGAQLG… |
| A0A7W1EJW8 | 2-220 | None |
| A0A1E9Z8S5 | 27-308 | None |
| A0A2H5EXW4 | 3-174 | None |
| A0A3M0XU52 | 1-215 | None |
| A0A2S9XKF3 | 2-267 | None |
| A0A0Q9U451 | 3-163 | None |
| A0A413L8K8 | 2-260 | None |
| A0A433I1H1 | 4-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.