DPCstruct | MC31852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9VD91 | 33-136 | VLDGVSEEGVLEEAEFYNVTQLITLLKECINLRDQRPQTDKKRVYRVLQCREQELTQMISTLSDGWRFEQLISVGTQYHSNYSFDNS… |
| J9P1W5 | 1-116 | MAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYPVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQVCWGPRATPETSKLPSKAGP… |
| A0A6G0U4P3 | 94-203 | None |
| A0A7R8CZC4 | 210-316 | None |
| A0A3P7FT65 | 3-86 | None |
| A0A6P8HT32 | 88-202 | None |
| A0A3G1ZL42 | 126-231 | None |
| A0A553RDG0 | 675-777 | None |
| A0A0K0DEB5 | 113-214 | None |
| R7VR42 | 73-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.