DPCstruct | MC31851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 5.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 75.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9P0V2 | 1-67 | MASGVVVSDGVIKMFNDMKVPKSSTPEEVKKRKKAVLFCLSEDKKDIILEEEKLGGSAIISLEGKPL |
| A0A2K6USZ6 | 1-50 | ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE |
| A0A3L7I9P6 | 1-50 | None |
| A0A3P9JWL9 | 1-53 | None |
| A0A667HNF2 | 1-64 | None |
| A0A6J1VRX3 | 1-56 | None |
| A0A2U3ZW43 | 1-51 | None |
| A0A444V069 | 308-362 | None |
| L5LUH2 | 20-75 | None |
| A0A485MST7 | 84-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.