DPCstruct | MC3185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0TIZ3 | 149-273 | FKGVLDTLPHVMTRSSLMIERLGIRPEYINSEQGGYQYHGRSGFEGKKTSLSQEQALQISQRLVVSMLRNTGFESATQLPIEIISQL… |
| A0A392QR11 | 1-111 | MPPVVTRSAEHVNGQRGGGLNRGKLGSEENGRVLGHEEAAKLSQKVVARILLGAGFEAAMEGPIEYLSDVMSKRIVKIGTNLKVLTD… |
| Q8GXR1 | 272-406 | None |
| A0A7I8K8A2 | 325-449 | None |
| U5CWN3 | 162-297 | None |
| A0A3L6THD2 | 268-389 | None |
| A0A5P1ERW1 | 283-405 | None |
| A0A6P5NNY8 | 274-398 | None |
| A0A162AM20 | 262-384 | None |
| A0A830DBP4 | 167-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.