DPCstruct | MC31847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 90.69 |
| Assigned Pfam label(s) | CL0063- PF00571- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1CQJ7 | 15-92 | LGLTFDDLRLKTGYSEVTPNKVELGSHFSRNIKLYFPLVSAAMDTVTEREMAIAMADFGGLGIIHRNMTPTNQANQVS |
| A0A822ALI6 | 6-88 | ADLKLDFKDVLVRPKRSSLKSRSEVDLVRTFTFRNSKQTYTGIPIIAANMDTVGTFQMAKALGKHTLFTAIHKHYTLEDWKNF |
| A0A447LJ85 | 1-87 | None |
| R9NZF9 | 499-611 | None |
| A0A011PXV6 | 22-105 | None |
| A0A0R3Q6G1 | 14-105 | None |
| A0A368FZR0 | 1-74 | None |
| A0A2I4AVY0 | 214-288 | None |
| A0A1M3PT01 | 4-68 | None |
| A0A4Q3NZ95 | 7-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.