DPCstruct | MC31844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 96.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800CXV0 | 96-219 | TTGIVSRGGSILAKWCLAHHRENFLYTHFEDICELLKQYDVGFSLGDGLRPGCLQDANDEAQFAELTTLGELTKLAWKHDVQTFIEG… |
| A0A1W2CWG0 | 3-99 | ANKKENPLYEQFDRVYDLMKKYDAVLSLGNGIRAGAIHDSHDRAQMAEMIINCELAELGREKGCQMMVEGLGHVPLDEIEGNIMLEK… |
| A0A1B0C474 | 349-472 | None |
| W4QG28 | 1-83 | None |
| A0A2R7QBU0 | 330-453 | None |
| A0A379W0F0 | 348-471 | None |
| A0A1V3WPI7 | 180-303 | None |
| A0A4Y6UBA1 | 287-407 | None |
| A0A5E6NT43 | 1-81 | None |
| A0A7C3XTM9 | 271-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.