DPCstruct | MC31841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 269 ± 55 aa |
| Standard deviation of domain lengths | 55.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1BK36 | 18-196 | LSPSAAQNDSCFSLSGSTTCAAFQDYYISLTGLATQYPFLKKVTDIKTFDAGMQSFVTSPQFYLAPLGCTNKANVASKIPYARYSMT… |
| A0A1Y2C039 | 3-236 | CLPLINSTMCPSFQHYSAYLVTGLPVTDVPSFDTYIQTSIDTSLNQYSFGEMMRTAFNCPGWNGLGLRYHQSVFCGYLTALCAQFAP… |
| A0A507FKK2 | 1-450 | None |
| A0A507FPA0 | 4-250 | None |
| A0A507FQ79 | 6-247 | None |
| A0A1S8W7R0 | 11-284 | None |
| A0A1Y1VHU4 | 52-391 | None |
| A0A1X2IMK5 | 2-319 | None |
| A0A1Y2HQ24 | 22-355 | None |
| A0A1Y1Y0T8 | 19-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.