DPCstruct | MC3184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368KRC7 | 16-194 | QIRRHATDLFNQQCWCWGRDVLRPEGNWLQELGFEKLKPPADRKDCSSSVYQLSLSGGRCVVLRGFGAYFGDRKLGGVFLSRNKFEP… |
| A0A7V8X4M5 | 25-205 | TRVFCLPADMRRNADSLLNQQFWLWGQDIRRREDNALLRYGFTRTRPPENTQGSNCYVLQLADHRMVALWGFGFFYGERIRGGIYVP… |
| A0A345UN10 | 6-178 | None |
| A0A4Q2YCQ4 | 2-153 | None |
| A0A841HYA9 | 3-167 | None |
| A0A3E0PLI5 | 5-158 | None |
| A0A7W9SR48 | 8-165 | None |
| A0A838ERM5 | 13-191 | None |
| A0A368B5F6 | 35-231 | None |
| A0A7J4SZH0 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.