DPCstruct | MC31832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7NA44 | 5-88 | YGISSPEEARAYLAHDILGPRLHECAQLVNQIPGRSIQEIFGPPDDLKLCSSMTLFARATDDNADFVALLAKYYGGGEDQRTVA |
| A0A1X0SX60 | 39-135 | AGLGSSPMAQRYAIQSLDEAKDYLAHELLGRRLAECTAAVLAHPDSTVHAIFGSPDDMKFHSSMTLFHRADPRDELFGQALEVFFDG… |
| A0A1Y2E612 | 2-93 | None |
| A0A1G7VYX5 | 42-146 | None |
| A0A1S9ZG38 | 3-87 | None |
| R5V0C8 | 42-140 | None |
| A0A0P8ZY52 | 39-176 | None |
| A0A521CQQ5 | 88-183 | None |
| A0A1M6SKK3 | 259-351 | None |
| A0A194XEC6 | 54-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.