DPCstruct | MC31828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3DLT5 | 3-144 | MLKEFRDFAIKGNVIDLAIGVIIGAAFGTIVSSLVDDMFMPVIGLILGRVDFSNLFIVLNNPNDVAVASLAAAKEAGVATLNIGLFI… |
| A0A5B8LEL8 | 2-126 | FKEFKAFIMRGNVMDLAIAVIIGAAFGKIVTSLTDDIIMPLIGKVFGGLDFSSYFLVLNADKVPPALAGSTDYAALKKAGVPLLGYG… |
| A0A352TTZ4 | 2-130 | None |
| A0A377DA89 | 2-88 | None |
| H1LKX5 | 37-140 | None |
| A0A819LN65 | 4-127 | None |
| A0A1Y2HCL8 | 18-174 | None |
| A0A7W5JYG6 | 2-119 | None |
| E7GPJ5 | 7-129 | None |
| A0A2T8F682 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.