DPCstruct | MC31827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5H1J9 | 205-272 | IDWLRQNNSYYKYGFRSVGKPRFISRDNFQAIIEIRLIEQYTMYRNGRVIESESDYYDKVVRFVLRKE |
| A0A846AWF7 | 1-73 | MSSRVNWLRKNGGEYTYDSIQVEPQGQFFVEGDQVIVDVKVSENRTLSIQGQIDWSRTGCTTSVYRWTLQREF |
| A0A6P0U0D7 | 341-408 | None |
| A0A1X9LG98 | 161-233 | None |
| Q117J5 | 167-232 | None |
| A0A6P1AJW6 | 569-634 | None |
| K9TBX2 | 207-274 | None |
| A0A1C0VXY3 | 181-250 | None |
| A0A838WXG1 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.