DPCstruct | MC31822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 237 ± 33 aa |
| Standard deviation of domain lengths | 32.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1ZWT1 | 3-221 | HQKHPQIFVPLPDLPPMISDGVRPRQIWVPADGYGDPSSNTVARSINTLRGHPTWKIFCRDVPLPLIRDTPTEPPHYVYLDDAACHA… |
| A0A6A6S799 | 2-262 | ASPDTKSTMVSDGKRMRPVWKPGNGNGDSAAYTIQRSLLTIKGHPTWKIYIDDIVLPIVRDSADEPPRYVYLDDRACYTIWCTGTYT… |
| A0A4Z1P0M7 | 1-245 | None |
| A0A1V8UXT4 | 14-313 | None |
| A0A1Z5TE78 | 1-226 | None |
| A0A1J9SLQ0 | 105-360 | None |
| A0A101MJ06 | 1-158 | None |
| A0A6A5QCS1 | 1-270 | None |
| A0A6A6D068 | 1-253 | None |
| A0A4U0UGI8 | 93-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.