DPCstruct | MC31821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6FP87 | 112-191 | NDPIEMLSPVYQGLTCQPTTNPNATCSLGGYPAYAVNVSSVAHIQLAINFARQTGVRLVVKNTGHDSSGKSGGAGALSIW |
| A0A1Y1ZWL9 | 6-92 | WEACGNSACFFLSFDPIEQLYDTCSLGTLAPYYVDVREPSHISAALQFSQEHNIRISINNTGHDFYGRSGGSNTLAIWTHNLSTMSF |
| A0A4Z1H8M2 | 78-137 | None |
| A0A423WQG5 | 149-234 | None |
| A0A4V1XRC5 | 280-359 | None |
| A0A421D5S7 | 310-391 | None |
| A0A4S8MD48 | 463-551 | None |
| A0A816DB25 | 59-137 | None |
| A0A815FSW8 | 77-155 | None |
| A0A1L7WUY3 | 14-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.