DPCstruct | MC31817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 139 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8YKB7 | 6-133 | GERLFYKGEETWMAAEPLNQYLQNRNDIKFISPSTACWRGYFGQWEIKDNKLYLIGLKAYIEGYREVDLSYLFPRQRQVIADWFSGK… |
| A0A075HGH8 | 2-148 | ILDRVRWTIIDFRPECPFNWEDYDVRPVQACTACWDGHLEVYSLRDNRLNLKESSVNLYEEEGDSGEWKPVVGPDVNGVSAERLDNL… |
| A0A2E6JZ93 | 11-118 | None |
| A0A511TIN4 | 2-153 | None |
| A0A7R7GEB0 | 1-123 | None |
| A0A5C7XF20 | 12-112 | None |
| A0A142WPI2 | 1-91 | None |
| A0A1P8JQG0 | 3-117 | None |
| A0A5P5ZK31 | 3-139 | None |
| A0A4R1D371 | 3-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.