DPCstruct | MC31814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 233 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9YTA6 | 2-231 | CDESRLHGVGLTENHEVLWLGRNSTGVSGLASVVDGTPGVAQVETATVGSWSTAAGDLIITVTSDGVTADPVNVTLDGTESANMIVN… |
| A0A072YT05 | 282-493 | ALIKSEITQTAQKSRLGNYQVTTVMIQGTVKENGVFQVAGERVEVQKGDDYSKVAHKIYNKFKNNENWLVEFKYVQAGYKANITFTS… |
| A0A386YJK1 | 183-434 | None |
| A0A6M5XUS6 | 2-190 | None |
| W5YMK9 | 87-323 | None |
| A0A2Z4WE61 | 1-296 | None |
| A0A0F9DI41 | 36-269 | None |
| A0A4R6WV95 | 471-683 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.