DPCstruct | MC3181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4NQM1 | 3-77 | NARISHQAEYKNYKIKRYDSGTIEVLKDGVVQSQALPVLRRLAPFVSVDISNGAGNPKNTRTLGIDIIQKIKSIN |
| A0A366HEH8 | 19-100 | NGRQIDFEPAIKGTTEASYKDYVITRLSTGAIKLERDGLPIEPVSPELRRLAGELNVPTANKQGNPHNTQVLGRELIKAINA |
| A0A1S7MVC4 | 115-190 | None |
| A0A8B0HZI4 | 147-221 | None |
| Q0ABC7 | 1-72 | None |
| A0A8A8V5P3 | 8-74 | None |
| A0A158CS15 | 107-174 | None |
| A0A427FPV5 | 518-591 | None |
| A0A7Z0P8Y3 | 455-523 | None |
| A0A2N8K0S7 | 72-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.