DPCstruct | MC31802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1I0M5 | 112-231 | VFPLSNWTELDIWQYIYLENIEIVPLYLAAERPVLERDGMLMMIDDDRIDLQPGEVIEKRMVRFRTLGCWPLTGAVESEAQTLPEII… |
| A0A7W3LYL8 | 1-121 | MFPLSNWTELDIWDYIRRERLELPSIYFAHTRRVFERDGMLLDAETGFANRGEDEPEFEASVRYRTVGDASCTGAVKSAAVSLDEVI… |
| A0A447TWG9 | 30-140 | None |
| A0A562KTR8 | 330-449 | None |
| A0A7W1UTZ9 | 122-241 | None |
| A0A7W0WXK1 | 19-138 | None |
| B1HKH8 | 257-376 | None |
| Q3JQW7 | 520-639 | None |
| A0A3P1SSR0 | 457-576 | None |
| A0A6F8NTA1 | 235-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.