DPCstruct | MC31800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8IK53 | 55-130 | EPLMSAIGAARYRRDAAEAEIRRLVAYGREFTRPRPYKLADLAAASGMSISGVRTAYDHEEVADVQKATGLKPRDW |
| A0A7W3LPH1 | 1-79 | MTEPTNADPVLDRLRDAARRRAQADREIRALLAYARHFTRPRPYRLADLATATGMSISGVRGAYTARDVELIADLFANR |
| A0A7H8TM25 | 76-161 | None |
| A0A367EJB1 | 51-133 | None |
| A0A852Z5Z9 | 56-130 | None |
| A0A5J6ESI3 | 1-83 | None |
| A0A358SN72 | 1-79 | None |
| A0A2G7EKT6 | 88-170 | None |
| A0A3N9WB62 | 57-126 | None |
| A0A4V4HP84 | 58-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.