DPCstruct | MC3180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366H5U7 | 9-69 | EPQPASAAVMARRQVRVLSKRDNGFIEFEFSIGWPELAVELMMTEEDFLDFCKAQSIQPSE |
| A0A0R0A2J8 | 1-51 | MPKYVRVRSDPDDKFVMFDFAIGESSLFVELVLPPESFKEFCANNNVINMT |
| A0A238D8Z3 | 8-67 | None |
| A0A366MNL9 | 9-61 | None |
| A0A7Y0CQ41 | 33-88 | None |
| A0A847JBV4 | 1-54 | None |
| A0A7Z1KTG0 | 2-60 | None |
| A0A643FFM2 | 1-54 | None |
| A0A2N5C634 | 2-55 | None |
| A0A2G2IEE3 | 12-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.