DPCstruct | MC318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 175 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6KS64 | 216-369 | WNVEANDGQHARIDLGHYTLDIDQSSSQFVLTNKATGEVTRIWGDPHFDNNGQAIGTFKGTLTLSLDDGTKLTINTTPAGNGEFYSS… |
| A0A0E3VTJ4 | 1-162 | MWSHEVRDGKAEIKLGDKYSILVDENDGTVLIRNSQTGKITSIKGDPHVDADGDGKVDFDFKENMTFQLDDGTKITVDTVDIGKGKT… |
| A0A6J5DTI7 | 135-322 | None |
| A0A158BC07 | 93-272 | None |
| A0A5C8J3X5 | 44-222 | None |
| A0A329DQ28 | 163-344 | None |
| A0A2N2P5R1 | 114-284 | None |
| A0A4Q5UFG4 | 31-221 | None |
| A0A2E6VSR0 | 97-282 | None |
| A0A1Y5GVM0 | 85-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.